PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G318300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 315aa    MW: 34631.9 Da    PI: 7.8232
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G318300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27.1e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Sevir.7G318300.1.p 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding47.54.1e-1567112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T+ E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  Sevir.7G318300.1.p  67 RGNFTPHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129425.042965IPR017930Myb domain
SuperFamilySSF466893.26E-3011108IPR009057Homeodomain-like
SMARTSM007174.4E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001678.93E-121661No hitNo description
Gene3DG3DSA:1.10.10.606.5E-2465117IPR009057Homeodomain-like
SMARTSM007175.4E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.7466116IPR017930Myb domain
PfamPF002495.5E-1367112IPR001005SANT/Myb domain
CDDcd001675.49E-969110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PINTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF TPHEEGIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKHQ  120
AIGAIFAPPP PSSESSSIIP TTAGASHHVD LHHDIIGSKD YNYARPAACS NPXEVTQLIA  180
RRSPFAATDG DSSSSSYASS MDNISKLLNG FMKSSPPTQN DATADIKPCA TDINPLLSFN  240
HMSGGSNTLP PSPPPQQQPA LTMGHRGYDN EPKQQHHQQG PLSPIEKWLF EEAAEQVVDL  300
MDLSDACCSV PMMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283081e-164KJ728308.1 Zea mays clone pUT6588 MYB transcription factor (MYB69) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977433.10.0PREDICTED: transcription factor MYB30-like
SwissprotQ9SCU74e-90MYB30_ARATH; Transcription factor MYB30
TrEMBLK3Y8R60.0K3Y8R6_SETIT; Uncharacterized protein
STRINGSi010608m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.12e-83myb domain protein 30